PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.17G010200.1.p
Common NameGLYMA_17G010200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family TALE
Protein Properties Length: 270aa    MW: 30751 Da    PI: 6.9419
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.17G010200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.31.5e-091952311955
                          HHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
             Homeobox  19 FeknrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                           +k +yps++++  LA+++gL+++q+ +WF N+R ++
  Glyma.17G010200.1.p 195 HYKWPYPSESQKLALAESTGLDQKQINNWFINQRKRH 231
                          45679*****************************885 PP

2ELK38.72.1e-13151171121
                  ELK   1 ELKhqLlrKYsgyLgsLkqEF 21 
                          ELK qLlrKY+gyLgsLkqEF
  Glyma.17G010200.1.p 151 ELKGQLLRKYRGYLGSLKQEF 171
                          9*******************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012553.1E-201458IPR005540KNOX1
PfamPF037905.4E-221554IPR005540KNOX1
SMARTSM012562.0E-2663114IPR005541KNOX2
PfamPF037917.5E-2366113IPR005541KNOX2
PfamPF037893.9E-9151171IPR005539ELK domain
PROSITE profilePS5121311.139151171IPR005539ELK domain
SMARTSM011885.9E-7151172IPR005539ELK domain
PROSITE profilePS5007113.167171234IPR001356Homeobox domain
SMARTSM003891.2E-12173238IPR001356Homeobox domain
SuperFamilySSF466891.11E-19173249IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.9E-28176236IPR009057Homeodomain-like
CDDcd000863.06E-12183235No hitNo description
PfamPF059204.3E-17191230IPR008422Homeobox KN domain
PROSITE patternPS000270209232IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 270 aa     Download sequence    Send to blast
MEIPNNNYGG SSSSAIKAKI MAHPHYHRLL AAYVNCQKVG APPEVMGRLE EACASAAVTM  60
AGGTASIGED PELDQFMEAY CEMLIKYEQE LSKPFKEAML FLQRIECQFK SLTISSSLDT  120
TACNEAIDRN GSSDDVDVQT NIIDPQAEDQ ELKGQLLRKY RGYLGSLKQE FTKKRKKGKL  180
PKEARQQLLE WWSRHYKWPY PSESQKLALA ESTGLDQKQI NNWFINQRKR HWKPSEDMQF  240
VVVDPSHPHY YMENVLGNPF PMNLSHTML*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1166175LKQEFTKKRK
2172176KKRKK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.256080.0flower| root| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ8573390.0DQ857339.1 Glycine max KNT1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001237352.11e-178KNT1
SwissprotP466081e-152HSBH1_SOYBN; Homeobox protein SBH1
TrEMBLK7MJC60.0K7MJC6_SOYBN; Uncharacterized protein
STRINGGLYMA17G01370.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20393480
Representative plantOGRP16717148
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.11e-129KNOX/ELK homeobox transcription factor